PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G247100.1
Common NameB456_010G247100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 414aa    MW: 45076.1 Da    PI: 8.2162
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G247100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.61.4e-3347101155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+rlrWt+eLH+rFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Gorai.010G247100.1  47 KQRLRWTHELHDRFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 101
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.01444104IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-3246102IPR009057Homeodomain-like
SuperFamilySSF466891.58E-1746101IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-2547102IPR006447Myb domain, plants
PfamPF002493.5E-949100IPR001005SANT/Myb domain
PfamPF143791.4E-9133154IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
PfamPF143791.4E-7235258IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MYHPKTVPGS SLVRSNSLVH GQHLDCGASS MDPVSGGNSS NPNLASKQRL RWTHELHDRF  60
VDAVAQLGGP DRATPKGVLR VMGVQGLTIY HVKSHLQKYR LAKYLPDSSS DGKKPDKKET  120
GDMLSNLDGS SGMQITEALK LQMEVQKRLH EQLEACILNA NLILICYYVC LALLAIWSSM  180
VLSVNNIRAQ YFSLYLLRNR CNLLYYCAVT HALSFWCFIY LSSQNTDFTS DIQQVQRQLQ  240
LRIEAQGKYL KKIIEEQRLG GVLAEAPGTG ASVPALGDNG LESDKKTDPA TPAPTSESPL  300
QDKAAKEGTS AKSHSVDESF SSHHEPLTPD SGCHVGSPAG SPKGEMLKKK QRVSMAGAFA  360
KPEMVLPHQI LDSSINASYQ QSQSVFMGEQ FNPSSGISIR NENQSGKGSG TEL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308734.21e-157myb family transcription factor family protein
TrEMBLA0A0D2RD950.0A0A0D2RD95_G
STRINGPOPTR_0006s00290.11e-157(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM87532536
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.15e-61G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]